Beauty Connection!

cali-curl

(17 Items)
  • 137694 SO2218P SO2218P 1 Buy 8 Beach Wave Systems, Get Retail Items FREE 13 pc. Cali-Curl Cali-Curl Buy 8 Beach Wave Systems, Get Retail Items FREE 13 pc. False calicurl/calicurlb8beachwavesystemsgretailitemsfree.jpg Bonus Deal Available 240.00 240.00 240.00 False True Valid Thru 10/31/22 False 0.00 False False Diversion contract is required 0 Cali-Curl Buy 8 Beach Wave Systems, Get Retail Items FREE includes system, shampoo, conditioner, mist, mask, and serum.
    Purchase 8:
    Beach Wave Systems
    (Each Includes: 1 Beach Wave Activator 4 oz., 1 Beach Wave Neutralizer 4 oz., 2 Bond Generator 0.5 oz., 1 Bond Extender 1.69 oz.)
    Receive 1 Each FREE:
    Hydrating Shampoo 10 oz.
    Protein Infused Conditioner 10 oz.
    Bond Therapy Mist 8 oz.
    Bond Therapy Masque 6 oz.
    Anti-Flyaway Serum 8 oz.
    True Log in to view pricing! False
    Cali-Curl Buy 8 Beach Wave Systems, Get Retail Items FREE 13 pc.

    Cali-Curl
    Buy 8 Beach Wave Systems, Get Retail Items FREE

    13 pc.

    SKU SO2218P

    Promotional ItemLog in to view pricing!
    Quick View
  • 138788 CCRETAILKIT CCRETAILKIT 1 Try Me Kit 20 pc. Cali-Curl Cali-Curl Try Me Kit 20 pc. False calicurl/calicurlprimeintro.jpg Bonus Deal Available 216.00 216.00 216.00 False True False 0.00 False False Diversion contract is required 0 Cali-Curl Try Me Kit includes shampoos, conditioners, mists, masks and serums. True Log in to view pricing! False
    Cali-Curl Try Me Kit 20 pc.

    Cali-Curl
    Try Me Kit

    20 pc.

    SKU CCRETAILKIT

    Promotional ItemLog in to view pricing!
    Quick View
  • 130991 CC0121-307 CC0121-307 1 Anti-Flyaway Serum 8 Fl. Oz. Cali-Curl Cali-Curl Anti-Flyaway Serum 8 Fl. Oz. False calicurl/calicurlantiflyawayserum.jpg Bonus Deal Available 14.00 14.00 14.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Anti-Flyaway Serum is a daily-use lightweight serum with just a little bit of hold specially designed to tame flyaway hair through conditioning agents and active bond repairing ingredients. True Log in to view pricing! False
    Cali-Curl Anti-Flyaway Serum 8 Fl. Oz.

    Cali-Curl
    Anti-Flyaway Serum

    8 Fl. Oz.

    SKU CC0121-307

    Quick View
  • 130978 CC0121-204 CC0121-204 1 Beach Wave Rings - Large 6 pc. Cali-Curl Cali-Curl Beach Wave Rings - Large 6 pc. False calicurl/calicurlbeachwaveringslarge.jpg Bonus Deal Available 35.00 35.00 35.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Beach Wave Rings - Large work best to achieve a looser volumizing wave on long hair. These patented waving tools are designed to achieve beautiful beach waves, volume and texture.

    FOR PROFESSIONAL USE ONLY
    True Log in to view pricing! False
    Cali-Curl Beach Wave Rings - Large 6 pc.

    Cali-Curl
    Beach Wave Rings - Large

    6 pc.

    SKU CC0121-204

    Quick View
  • 130975 CC0121-202 CC0121-202 1 Beach Wave Rings - Medium 6 pc. Cali-Curl Cali-Curl Beach Wave Rings - Medium 6 pc. False calicurl/calicurlbeachwavesmedium.jpg Bonus Deal Available 35.00 35.00 35.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Beach Wave Rings - Medium work best to achieve a classic wave pattern. These patented waving tools are designed to achieve beautiful beach waves, volume and texture.

    FOR PROFESSIONAL USE ONLY
    True Log in to view pricing! False
    Cali-Curl Beach Wave Rings - Medium 6 pc.

    Cali-Curl
    Beach Wave Rings - Medium

    6 pc.

    SKU CC0121-202

    Quick View
  • 130976 CC0121-203 CC0121-203 1 Beach Wave Rings - Medium+ 6 pc. Cali-Curl Cali-Curl Beach Wave Rings - Medium+ 6 pc. False calicurl/calicurlbeachwavesringsmedium.jpg Bonus Deal Available 35.00 35.00 35.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Beach Wave Rings - Medium+ work best work best with longer/thicker hair to achieve a classic wave pattern. These patented waving tools are designed to achieve beautiful beach waves, volume and texture.

    FOR PROFESSIONAL USE ONLY
    True Log in to view pricing! False
    Cali-Curl Beach Wave Rings - Medium+ 6 pc.

    Cali-Curl
    Beach Wave Rings - Medium+

    6 pc.

    SKU CC0121-203

    Quick View
  • 130969 CC0121-201 CC0121-201 1 Beach Wave Rings - Small 6 pc. Cali-Curl Cali-Curl Beach Wave Rings - Small 6 pc. False calicurl/calicurlbeachwaveringssmall.jpg Bonus Deal Available 35.00 35.00 35.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Beach Wave Rings - Small work best with short or layered hair. These patented waving tools are designed to achieve beautiful beach waves, volume and texture.

    FOR PROFESSIONAL USE ONLY
    True Log in to view pricing! False
    Cali-Curl Beach Wave Rings - Small 6 pc.

    Cali-Curl
    Beach Wave Rings - Small

    6 pc.

    SKU CC0121-201

    Quick View
  • 130988 CC0121-309 CC0121-309 1 Bond Therapy Masque 6 Fl. Oz. Cali-Curl Cali-Curl Bond Therapy Masque 6 Fl. Oz. False calicurl/calicurltherapymasque.jpg Bonus Deal Available 16.00 16.00 16.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Bond Therapy Masque is a luxurious deep conditioning and patented bond reparative masque to use at home, once each week or anytime your hair needs an extra hydrating boost. True Log in to view pricing! False
    Cali-Curl Bond Therapy Masque 6 Fl. Oz.

    Cali-Curl
    Bond Therapy Masque

    6 Fl. Oz.

    SKU CC0121-309

    Quick View
  • 130994 CC0121-308 CC0121-308 1 Bond Therapy Mist 8 Fl. Oz. Cali-Curl Cali-Curl Bond Therapy Mist 8 Fl. Oz. False calicurl/calicurlbondtherapymist.jpg Bonus Deal Available 14.00 14.00 14.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Bond Therapy Mist is a daily-use sprayable patented bond repair primer that detangles, protects against elements and strengthens the hair. True Log in to view pricing! False
    Cali-Curl Bond Therapy Mist 8 Fl. Oz.

    Cali-Curl
    Bond Therapy Mist

    8 Fl. Oz.

    SKU CC0121-308

    Quick View
  • 131026 CC0121-300 CC0121-300 1 Cleansing Shampoo Liter Cali-Curl Cali-Curl Cleansing Shampoo Liter False calicurl/calicurlcleansingshampooliter.jpg Bonus Deal Available 30.00 30.00 30.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Cleansing Shampoo is a gentle yet effective cleansing shampoo that removes excess buildup from styling products, the environment and chemicals while maintaining the health of the hair.

    FOR PROFESSIONAL USE ONLY
    True Log in to view pricing! False
    Cali-Curl Cleansing Shampoo Liter

    Cali-Curl
    Cleansing Shampoo

    Liter

    SKU CC0121-300

    Quick View
  • 130986 CC0121-207 CC0121-207 1 Foam Diffuser Rings - Large 12 pc. Cali-Curl Cali-Curl Foam Diffuser Rings - Large 12 pc. False calicurl/calicurlfoamringslarge.jpg Bonus Deal Available 12.00 12.00 12.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Foam Diffuser Rings - Large are specifically designed to use with the Cali-Curl Beach Wave System to hold the hair in place and yield perfectly shaped ends.

    FOR PROFESSIONAL USE ONLY
    True Log in to view pricing! False
    Cali-Curl Foam Diffuser Rings - Large 12 pc.

    Cali-Curl
    Foam Diffuser Rings - Large

    12 pc.

    SKU CC0121-207

    Quick View
  • 130983 CC0121-206 CC0121-206 1 Foam Diffuser Rings - Medium/Medium+ 12 pc. Cali-Curl Cali-Curl Foam Diffuser Rings - Medium/Medium+ 12 pc. False calicurl/calicurlmediumfoamrings.jpg Bonus Deal Available 12.00 12.00 12.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Foam Diffuser Rings - Medium/Medium+ are specifically designed to use with the Cali-Curl Beach Wave System to hold the hair in place and yield perfectly shaped ends.

    FOR PROFESSIONAL USE ONLY
    True Log in to view pricing! False
    Cali-Curl Foam Diffuser Rings - Medium/Medium+ 12 pc.

    Cali-Curl
    Foam Diffuser Rings - Medium/Medium+

    12 pc.

    SKU CC0121-206

    Quick View
  • 130979 CC0121-205 CC0121-205 1 Foam Diffuser Rings - Small 12 pc. Cali-Curl Cali-Curl Foam Diffuser Rings - Small 12 pc. False calicurl/calicurlsmallfoamrollers.jpg Bonus Deal Available 12.00 12.00 12.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Foam Diffuser Rings - Small are specifically designed to use with the Cali-Curl Beach Wave System to hold the hair in place and yield perfectly shaped ends.

    FOR PROFESSIONAL USE ONLY
    True Log in to view pricing! False
    Cali-Curl Foam Diffuser Rings - Small 12 pc.

    Cali-Curl
    Foam Diffuser Rings - Small

    12 pc.

    SKU CC0121-205

    Quick View
  • 131027 CC0121-303 CC0121-303 1 Hydrating Shampoo 10 Fl. Oz. Cali-Curl Cali-Curl Hydrating Shampoo 10 Fl. Oz. False calicurl/calicurlhydratingshampoo10oz.jpg Bonus Deal Available 14.00 14.00 14.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Hydrating Shampoo reduces frizz without weighing down the curls, leaving gorgeous and replenished locks. True Log in to view pricing! False
    Cali-Curl Hydrating Shampoo 10 Fl. Oz.

    Cali-Curl
    Hydrating Shampoo

    10 Fl. Oz.

    SKU CC0121-303

    Quick View
  • 131034 MJ2270 CCPIK 1 Prime Intro Offer 19 pc. Cali-Curl Cali-Curl Prime Intro Offer 19 pc. False calicurl/calicurlprimeintro.jpg Bonus Deal Available 284.00 284.00 284.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Prime Intro Offer includes system, rings, shampoo, conditioner, mist, mask, serum and merchandise.  True Log in to view pricing! False
    Cali-Curl Prime Intro Offer 19 pc.

    Cali-Curl
    Prime Intro Offer

    19 pc.

    SKU MJ2270

    Quick View
(17 Items)